| IED ID | IndEnz0008000505 |
| Enzyme Type ID | cellulase000505 |
| Protein Name |
Endo-1,4-beta-xylanase A Xylanase A EC 3.2.1.8 1,4-beta-D-xylan xylanohydrolase A |
| Gene Name | xynA BSU18840 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW |
| Enzyme Length | 213 |
| Uniprot Accession Number | P18429 |
| Absorption | |
| Active Site | ACT_SITE 106; /note="Nucleophile"; /evidence="ECO:0000255|PROSITE-ProRule:PRU10062, ECO:0000269|PubMed:7911679"; ACT_SITE 200; /note="Proton donor"; /evidence="ECO:0000255|PROSITE-ProRule:PRU10063" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-xylosidic linkages in xylans.; EC=3.2.1.8; |
| DNA Binding | |
| EC Number | 3.2.1.8 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Glycan degradation; xylan degradation. |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (13); Chain (1); Domain (1); Helix (1); Mutagenesis (2); Signal peptide (1); Turn (1) |
| Keywords | 3D-structure;Carbohydrate metabolism;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Signal;Xylan degradation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..28 |
| Structure 3D | X-ray crystallography (15) |
| Cross Reference PDB | 1AXK; 1XXN; 2B42; 2B45; 2B46; 2DCY; 2DCZ; 2QZ3; 2Z79; 3EXU; 3HD8; 5K9Y; 5TVV; 5TVY; 5TZO; |
| Mapped Pubmed ID | 16289057; 16467302; 17983355; 19422059; 19769747; 28109807; 28925919; 9618460; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,345 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.2.1.8; |