IED ID | IndEnz0008000515 |
Enzyme Type ID | cellulase000515 |
Protein Name |
Endo-1,4-beta-xylanase G Xylanase G EC 3.2.1.8 1,4-beta-D-xylan xylanohydrolase G |
Gene Name | xynG |
Organism | Verticillium dahliae (Verticillium wilt) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Glomerellales Plectosphaerellaceae Verticillium Verticillium dahliae (Verticillium wilt) |
Enzyme Sequence | MVSFKSLLLAASAFTAVLGRPFDSFDGPDVNITDADELLVRRQVTANSEGTHNGYFYSWWSDGGGQVTYTMGAGSRYSVTWKDTGNFVGGKGWNPGTGRTINYGGSFSPQGNGYLAVYGWTRNPLIEYYVVESYGTYNPGSGGQLKGTVTTDGGTYNVYVSTRTNQPSIDGTRTFQQYWSVRTSKRVGGAVTMQNHFNAWAQFGMNLGAHYYQIVATEGYQSSGPSDIYVQTQCKSLCDRGRVTWRDVVC |
Enzyme Length | 250 |
Uniprot Accession Number | Q0ZHI9 |
Absorption | |
Active Site | ACT_SITE 127; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10062; ACT_SITE 218; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10063 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-xylosidic linkages in xylans.; EC=3.2.1.8; Evidence={ECO:0000269|PubMed:18720841}; |
DNA Binding | |
EC Number | 3.2.1.8 |
Enzyme Function | FUNCTION: Endo-1,4-beta-xylanase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. The most favorable substrate is beechwood xylan. {ECO:0000269|PubMed:18720841}. |
Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 45 degrees Celsius. {ECO:0000269|PubMed:18720841}; |
PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.0. {ECO:0000269|PubMed:18720841}; |
Pathway | PATHWAY: Glycan degradation; xylan degradation. |
nucleotide Binding | |
Features | Active site (2); Chain (1); Domain (1); Glycosylation (1); Signal peptide (1) |
Keywords | Carbohydrate metabolism;Glycoprotein;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted;Signal;Xylan degradation |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:18720841}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 27,410 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |