| IED ID | IndEnz0008000550 |
| Enzyme Type ID | cellulase000550 |
| Protein Name |
Endo-1,4-beta-xylanase B Xylanase B EC 3.2.1.8 1,4-beta-D-xylan xylanohydrolase B |
| Gene Name | xynB |
| Organism | Phanerodontia chrysosporium (White-rot fungus) (Sporotrichum pruinosum) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetes incertae sedis Polyporales Phanerochaetaceae Phanerodontia Phanerodontia chrysosporium (White-rot fungus) (Sporotrichum pruinosum) |
| Enzyme Sequence | MVSFNSLLVAVSAATCALAFPFEFHNGTHVFPRQSTPAGTGTNNGYFYSFWTDGGGSVTYNNGPAGEYSVTWSNADNFVAGKGWNPGSAQAISFTANYQPNGNSYLSVYGWSTNPLVEYYILEDFGTYNPAVSLTHKGTLTSDGATYDVYEGTRVNEPSIQGTATFNQYWSIRSSKRSSGTVTTANHFAAWKQLGLPLGTFNYQIVATEGYQSSGSSTVTVNPAGGVTSPIAPTGPSSVSTTPSGPSSSPSPVGTCSALYGQCGGQGWTGPTCCSSGTCKFSNNWYSQCL |
| Enzyme Length | 290 |
| Uniprot Accession Number | B7SIW1 |
| Absorption | |
| Active Site | ACT_SITE 118; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10062; ACT_SITE 209; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10063 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-xylosidic linkages in xylans.; EC=3.2.1.8; Evidence={ECO:0000269|PubMed:15278289, ECO:0000269|PubMed:16348798}; |
| DNA Binding | |
| EC Number | 3.2.1.8 |
| Enzyme Function | FUNCTION: Endo-1,4-beta-xylanase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. {ECO:0000269|PubMed:15278289, ECO:0000269|PubMed:16348798}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 60 degrees Celsius. {ECO:0000269|PubMed:15278289}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 4.5. {ECO:0000269|PubMed:15278289}; |
| Pathway | PATHWAY: Glycan degradation; xylan degradation. |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Domain (2); Glycosylation (1); Region (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Glycoprotein;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted;Signal;Xylan degradation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:15278289}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,466 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=9.96 mg/ml for birchwood xylan {ECO:0000269|PubMed:15278289}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |