| IED ID | IndEnz0008000580 |
| Enzyme Type ID | cellulase000580 |
| Protein Name |
Endo-1,4-beta-xylanase Xyn11B Xylanase 11B EC 3.2.1.8 1,4-beta-D-xylan xylanohydrolase |
| Gene Name | xyn11B |
| Organism | Cellvibrio japonicus (Pseudomonas fluorescens subsp. cellulosa) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Cellvibrionales Cellvibrionaceae Cellvibrio Cellvibrio japonicus (Pseudomonas fluorescens subsp. cellulosa) |
| Enzyme Sequence | MKIFQNTKNVIVSIAWAAALCTSAVSAQTLTSNSTGTNNGFYYTFWKDSGDASMTLLSGGRYQSSWNSSTNNWVGGKGWNPGSSSRVISYSGYYGVDSSQNSYLALYGWTRSPLIEYYVIESYGSYNPASCSGGTDYGSFQSDGATYNVRRCQRVNQPSIDGNQTFYQYFSVRNPKKGFGNISGTITFANHANFWATKGLNLGNHNYQVLATEGYQSRGSSDITVSQGGSSGGGNSSSSSSASGGGSKIIVVRARGTAGGESITLRVGNTNVATWTLTTTMTNYTATTSASGGSLVQYTNDSGNRDVQVDYISVNGSIRQSEDQTYNTGVYQNGSCGGGNGRSEWLHCNGAIGYGDI |
| Enzyme Length | 357 |
| Uniprot Accession Number | Q8VP72 |
| Absorption | |
| Active Site | ACT_SITE 116; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10062; ACT_SITE 213; /note=Proton donor; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-xylosidic linkages in xylans.; EC=3.2.1.8; Evidence={ECO:0000269|PubMed:12107129}; |
| DNA Binding | |
| EC Number | 3.2.1.8 |
| Enzyme Function | FUNCTION: Endo-acting xylanase which specifically cleaves internal linkages on the xylan backbone, releasing xylooligosaccharides. Is able to hydrolyze glucuronoxylan and the arabinoxylan from wheat. {ECO:0000269|PubMed:12107129}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Glycan degradation; xylan degradation. |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Domain (1); Region (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted;Signal;Xylan degradation |
| Interact With | |
| Induction | INDUCTION: Induced when the bacterium is cultured on xylan or beta-glucan but not on medium containing mannan. Is repressed by glucose. Transcription of xyn11B occurs later than transcription of xyn11A. Is expressed at maximum level in mid-log phase, and its transcription persists into the late exponential and early stationary phases. {ECO:0000269|PubMed:12107129}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:12107129}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 37,912 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |