| IED ID | IndEnz0009000015 |
| Enzyme Type ID | chitinase000015 |
| Protein Name |
Class V chitinase AtChiC EC 3.2.1.14 EC 3.2.1.200 |
| Gene Name | ChiC At4g19810 T16H5.170 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSSTKLISLIVSITFFLTLQCSMAQTVVKASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQVTVSSANQPKFSTFTQTVQRRNPSVKTLLSIGGGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYPSSATEMTNFGTLLREWRSAVVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALFDPSNAGPSGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAAISPDGSIGYGQIRKFIVDNGATTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNSGLSRAASQAWDATTATTRTIQKV |
| Enzyme Length | 379 |
| Uniprot Accession Number | O81862 |
| Absorption | |
| Active Site | ACT_SITE 140; /note="Proton donor"; /evidence="ECO:0000255|PROSITE-ProRule:PRU01258, ECO:0000305|PubMed:21390509" |
| Activity Regulation | |
| Binding Site | BINDING 99; /note="Chitin oligosaccharide; via amide nitrogen and carbonyl oxygen"; /evidence="ECO:0000305|PubMed:21390509"; BINDING 259; /note="Chitin oligosaccharide"; /evidence="ECO:0000305|PubMed:21390509"; BINDING 348; /note="Chitooligosaccharide"; /evidence="ECO:0000255|PROSITE-ProRule:PRU01258, ECO:0000305|PubMed:21390509" |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; Evidence={ECO:0000269|PubMed:21390509, ECO:0000269|PubMed:22936594}; CATALYTIC ACTIVITY: Reaction=Hydrolysis of N,N'-diacetylchitobiose from the non-reducing end of chitin and chitodextrins.; EC=3.2.1.200; Evidence={ECO:0000269|PubMed:21390509}; |
| DNA Binding | |
| EC Number | 3.2.1.14; 3.2.1.200 |
| Enzyme Function | FUNCTION: Can hydrolyze glycol chitin and chitin oligosaccharides (e.g. N-acetylglucosamine) (GlcNAc)4, (GlcNAc)5 and (GlcNAc)6 (PubMed:21390509, PubMed:22936594). Hydrolyzes N-acetylglucosamine oligomers producing dimers from the non-reducing end of the substrates (PubMed:21390509). {ECO:0000269|PubMed:21390509, ECO:0000269|PubMed:22936594}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Glycan degradation; chitin degradation. {ECO:0000269|PubMed:21390509, ECO:0000269|PubMed:22936594}. |
| nucleotide Binding | |
| Features | Active site (1); Alternative sequence (1); Beta strand (14); Binding site (3); Chain (1); Domain (1); Glycosylation (2); Helix (14); Mutagenesis (2); Sequence conflict (1); Signal peptide (1); Turn (5) |
| Keywords | 3D-structure;Alternative splicing;Carbohydrate metabolism;Chitin degradation;Glycoprotein;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Signal |
| Interact With | |
| Induction | INDUCTION: Induced by jasmonic acid (JA), abscisic acid (ABA) and salt (NaCl). {ECO:0000269|PubMed:21390509}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 3AQU; |
| Mapped Pubmed ID | 12805589; 14535885; 15047898; 15347791; 15489280; 15593128; 15763661; 15772289; 15894741; 16262716; 16553894; 17085508; 17149585; 17704230; 18539778; 18684332; 18796151; 21798944; 23858430; 27247031; 28627464; 28724081; |
| Motif | |
| Gene Encoded By | |
| Mass | 41,128 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.2.1.14;3.2.1.200; |