| IED ID | IndEnz0009000023 |
| Enzyme Type ID | chitinase000023 |
| Protein Name |
Chitinase-3-like protein 1 Mammary gland protein 40 SPB-40 |
| Gene Name | CHI3L1 MGP-40 |
| Organism | Bubalus bubalis (Domestic water buffalo) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bubalus Bubalus bubalis (Domestic water buffalo) |
| Enzyme Sequence | MGLRVAQTGFVVLVLLQSCAAYKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVPAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSDRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSYTLASSKTDVGAPISGPGIPGQFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLAFPLTNAIKDVLAGV |
| Enzyme Length | 383 |
| Uniprot Accession Number | Q7YS85 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 141; /note=Chitooligosaccharide; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258; BINDING 263; /note=Chitooligosaccharide; /evidence=ECO:0000250; BINDING 352; /note=Chitooligosaccharide; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Carbohydrate-binding lectin with a preference for chitin. Has no chitinase activity. May play a role in tissue remodeling and in the capacity of cells to respond to and cope with changes in their environment. Plays a role in T-helper cell type 2 (Th2) inflammatory response and IL-13-induced inflammation, regulating allergen sensitization, inflammatory cell apoptosis, dendritic cell accumulation and M2 macrophage differentiation. Facilitates invasion of pathogenic enteric bacteria into colonic mucosa and lymphoid organs. Mediates activation of AKT1 signaling pathway and subsequent IL8 production in colonic epithelial cells. Regulates antibacterial responses in lung by contributing to macrophage bacterial killing, controlling bacterial dissemination and augmenting host tolerance. Also regulates hyperoxia-induced injury, inflammation and epithelial apoptosis in lung (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (20); Binding site (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Helix (17); Region (4); Sequence conflict (12); Signal peptide (1); Turn (5) |
| Keywords | 3D-structure;Antimicrobial;Apoptosis;Cytoplasm;Disulfide bond;Endoplasmic reticulum;Glycoprotein;Inflammatory response;Lectin;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space. Cytoplasm {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000250}. Endoplasmic reticulum {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21 |
| Structure 3D | X-ray crystallography (12) |
| Cross Reference PDB | 1TFV; 2O9O; 2QF8; 4MAV; 4ML4; 4MPK; 4MTV; 4NSB; 4Q7N; 5Z05; 5Z3S; 5Z4W; |
| Mapped Pubmed ID | 29524427; |
| Motif | |
| Gene Encoded By | |
| Mass | 42,935 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |