| IED ID | IndEnz0009000026 |
| Enzyme Type ID | chitinase000026 |
| Protein Name |
Chitinase-like protein Idgf2 Imaginal disk growth factor protein 2 |
| Gene Name | Idgf2 CG4475 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MKAWIWFTFVACLFAASTEAASNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYDLVKTYGFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFTGDFIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL |
| Enzyme Length | 440 |
| Uniprot Accession Number | Q9V3D4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cooperates with insulin-like peptides to stimulate the proliferation, polarization and motility of imaginal disk cells. May act by stabilizing the binding of insulin-like peptides to its receptor through a simultaneous interaction with both molecules to form a multiprotein signaling complex. {ECO:0000269|PubMed:9847235}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (15); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Helix (20); Sequence conflict (2); Signal peptide (1); Turn (7) |
| Keywords | 3D-structure;Developmental protein;Disulfide bond;Glycoprotein;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:9847235}. Note=Secreted in hemolymph. It is probably transported to target tissues via hemolymph. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated. {ECO:0000269|PubMed:11821393}. |
| Signal Peptide | SIGNAL 1..20 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1JND; 1JNE; |
| Mapped Pubmed ID | 10462411; 10581276; 10779488; 10779493; 11861566; 12242232; 12586708; 12601174; 12727233; 12876199; 14605208; 14734306; 15094375; 15252443; 15466469; 15704171; 16880385; 17139322; 17594485; 18342250; 18628398; 19229299; 19234471; 20813047; 20816975; 21205821; 21611131; 21958154; 23071443; 23840627; 23944235; 25312911; 25492518; 26489095; 26509186; 26526100; 26801178; 26838602; 27894253; 28230183; 28404605; 30107045; 31635152; 31794428; 32770153; 32900993; 33370287; 34738617; |
| Motif | |
| Gene Encoded By | |
| Mass | 49,159 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |