| IED ID | IndEnz0009000082 |
| Enzyme Type ID | chitinase000082 |
| Protein Name |
Basic endochitinase EC 3.2.1.14 |
| Gene Name | |
| Organism | Nicotiana tabacum (Common tobacco) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
| Enzyme Sequence | MNIKVSLLFILPIFLLLLTSKVKAGDIVVYWGQDVGEGKLIDTCNSGLYNIVNIAFLSSFGNFQTPKLNLAGHCEPSSGGCQQLTKSIRHCQSIGIKIMLSIGGGTPTYTLSSVDDARQVADYLWNNFLGGQSSFRPLGDAVLDGIDFDIELGQPHYIALARRLSEHGQQGKKLYLTAAPQCPFPDKLLNGALQTGLFDYVWVQFYNNPECEFMSNSENFKRRWNQWTSIPAKKLYIGLPAAKTAAGNGYIPKQVLMSQVLPFLKGSSKYGGVMLWNRKFDVQCGYSSAIRGAV |
| Enzyme Length | 294 |
| Uniprot Accession Number | P29061 |
| Absorption | |
| Active Site | ACT_SITE 151; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; |
| DNA Binding | |
| EC Number | 3.2.1.14 |
| Enzyme Function | FUNCTION: This protein functions as a defense against chitin containing fungal pathogens. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Chitin degradation;Disulfide bond;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Signal |
| Interact With | |
| Induction | INDUCTION: By TMV infection. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,393 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |