| IED ID | IndEnz0009000087 |
| Enzyme Type ID | chitinase000087 |
| Protein Name |
Bifunctional chitinase/lysozyme Includes: Chitinase EC 3.2.1.14 ; Lysozyme EC 3.2.1.17 Fragment |
| Gene Name | |
| Organism | Parthenocissus quinquefolia (Virginia creeper) (Hedera quinquefolia) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids rosids incertae sedis Vitales Vitaceae Parthenocisseae Parthenocissus Parthenocissus quinquefolia (Virginia creeper) (Hedera quinquefolia) |
| Enzyme Sequence | GGIAIYWGQNGNEGTLTQTCNTGKYSYVNIAFLNKFGNGQTPEINLA |
| Enzyme Length | 47 |
| Uniprot Accession Number | P23473 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.; EC=3.2.1.17; |
| DNA Binding | |
| EC Number | 3.2.1.14; 3.2.1.17 |
| Enzyme Function | FUNCTION: Bifunctional enzyme with lysozyme/chitinase activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Non-terminal residue (1) |
| Keywords | Carbohydrate metabolism;Chitin degradation;Direct protein sequencing;Glycosidase;Hydrolase;Multifunctional enzyme;Polysaccharide degradation;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,040 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |