| IED ID | IndEnz0009000088 |
| Enzyme Type ID | chitinase000088 |
| Protein Name |
Endochitinase A CHN-A EC 3.2.1.14 |
| Gene Name | CHN48 |
| Organism | Nicotiana tabacum (Common tobacco) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
| Enzyme Sequence | MRLCKFTALSSLLFSLLLLSASAEQCGSQAGGARCPSGLCCSKFGWCGNTNDYCGPGNCQSQCPGGPTPTPPTPPGGGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQRSFGNGLLVDTM |
| Enzyme Length | 329 |
| Uniprot Accession Number | P08252 |
| Absorption | |
| Active Site | ACT_SITE 145; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:P29022 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; |
| DNA Binding | |
| EC Number | 3.2.1.14 |
| Enzyme Function | FUNCTION: Defense against chitin-containing fungal pathogens. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (7); Domain (1); Modified residue (6); Propeptide (1); Sequence conflict (2); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Chitin degradation;Chitin-binding;Disulfide bond;Glycosidase;Hydrolase;Hydroxylation;Plant defense;Polysaccharide degradation;Reference proteome;Signal;Vacuole |
| Interact With | |
| Induction | INDUCTION: By ethylene. |
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole {ECO:0000269|PubMed:1946457}. Note=Vacuolar and protoplast. |
| Modified Residue | MOD_RES 67; /note=4-hydroxyproline; partial; /evidence=ECO:0000269|PubMed:1496378; MOD_RES 69; /note=4-hydroxyproline; /evidence=ECO:0000269|PubMed:1496378; MOD_RES 71; /note=4-hydroxyproline; /evidence=ECO:0000269|PubMed:1496378; MOD_RES 72; /note=4-hydroxyproline; /evidence=ECO:0000269|PubMed:1496378; MOD_RES 74; /note=4-hydroxyproline; /evidence=ECO:0000269|PubMed:1496378; MOD_RES 75; /note=4-hydroxyproline; partial; /evidence=ECO:0000269|PubMed:1496378 |
| Post Translational Modification | PTM: The 4-hydroxyproline residues are not glycosylated in this plant vacuolar protein. |
| Signal Peptide | SIGNAL 1..23 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 7766882; |
| Motif | |
| Gene Encoded By | |
| Mass | 35,156 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |