Detail Information for IndEnz0009000090
IED ID IndEnz0009000090
Enzyme Type ID chitinase000090
Protein Name Chitinase 1
EC 3.2.1.14
Gene Name chi1
Organism Yersinia entomophaga
Taxonomic Lineage cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Yersinia Yersinia entomophaga
Enzyme Sequence MEKEEKSNLIYDKDPGYVWDNKNECEGAAEETYQELNYEPSISADKLTWTPTRLAKTVFNTYEDDDDFNVLCYFTDWSQYDPRIINKEIRDTGGRSADILRLNTPDGRPFKRLIYSFGGLIGDKKYSADGNASIAVRLGVATDPDDAIANHKGKTIPVDPDGAVLASINCGFTKWEAGDANERYNQEKAKGLLGGFRLLHEADKELEFSLSIGGWSMSGLFSEIAKDEILRTNFVEGIKDFFQRFPMFSHLDIDWEYPGSIGAGNPNSPDDGANFAILIQQITDAKISNLKGISIASSADPAKIDAANIPALMDAGVTGINLMTYDFFTLGDGKLSHHTNIYRDPSDVYSKYSIDDAVTHLIDEKKVDPKAIFIGYAGYTRNAKNATITTSIPSEEALKGTYTDANQTLGSFEYSVLEWTDIICHYMDFEKGEGRNGYKLVHDKVAKADYLYSEATKVFISLDTPRSVRDKGRYVKDKGLGGLFIWSGDQDNGILTNAAHEGLKRRIKNKVIDMTPFYLDSDEELPTYTEPAEPQCEACNIK
Enzyme Length 542
Uniprot Accession Number B6A876
Absorption
Active Site ACT_SITE 256; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258
Activity Regulation ACTIVITY REGULATION: Toxin complex is secreted when grown at 25 degrees Celsius or less; at higher temperatures the proteins are present intracellularly but not secreted. {ECO:0000269|PubMed:21278295}.
Binding Site BINDING 257; /note=Chitooligosaccharide; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258; BINDING 486; /note=Chitooligosaccharide; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; Evidence={ECO:0000305|PubMed:22108167};
DNA Binding
EC Number 3.2.1.14
Enzyme Function FUNCTION: Part of an orally active toxin complex (TC) with strong insecticidal effects on larvae of the Coleoptera Costelytra zealandica, Acrossidius tasmania and Adoryphorus couloni and some Lepidoptera larvae (PubMed:21278295). The TC has an endochitinase activity (PubMed:21278295, PubMed:22158901) (Probable). This subunit might aid infection by degradation of the larval peritrophic membrane (Probable). {ECO:0000269|PubMed:21278295, ECO:0000269|PubMed:22158901, ECO:0000305|PubMed:22108167}.
Temperature Dependency
PH Dependency BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.0, in the intact toxin complex optimum pH is pH 4.0 to pH 8.0. {ECO:0000269|PubMed:22108167};
Pathway
nucleotide Binding
Features Active site (1); Beta strand (21); Binding site (2); Chain (1); Domain (1); Helix (22); Region (3); Turn (11)
Keywords 3D-structure;Carbohydrate metabolism;Chitin degradation;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted;Virulence
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:21278295}. Note=Secreted when grown at 25 degrees Celsius or less, but not when grown at 30 or 37 degrees Celsius. {ECO:0000269|PubMed:21278295}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D X-ray crystallography (1); Electron microscopy (1)
Cross Reference PDB 3OA5; 4A5Q;
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 60,385
Kinetics BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=580 uM for 4-methylumbelliferyl-beta-D-N,N',N''-triacetylchitotrioside {ECO:0000269|PubMed:22108167}; Note=In the intact toxin complex the combined chitinase activity of Chi1 and Chi2 is slightly reduced. {ECO:0000269|PubMed:22108167};
Metal Binding
Rhea ID
Cross Reference Brenda