| IED ID | IndEnz0009000138 |
| Enzyme Type ID | chitinase000138 |
| Protein Name |
Hevein-like preproprotein Cleaved into: CB-HEL; CD-HEL EC 3.1.-.- RNase |
| Gene Name | HEL At3g04720 F7O18.21 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MKIRLSITIILLSYTVATVAGQQCGRQGGGRTCPGNICCSQYGYCGTTADYCSPTNNCQSNCWGSGPSGPGESASNVRATYHFYNPAQNNWDLRAVSAYCSTWDADKPYAWRSKYGWTAFCGPAGPRGQASCGKCLRVKNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDGFGYQQGHLIVDYQFVDCGNELIGQPDSRNMLVSAIDRV |
| Enzyme Length | 212 |
| Uniprot Accession Number | P43082 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: Fungal growth inhibitors. Neither CB-HEL nor CD-HEL have chitinase activity, but both have antimicrobial activities. CD-HEL has RNase, but no DNase activity. {ECO:0000269|PubMed:22868784}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (3); Disulfide bond (7); Domain (2); Signal peptide (1) |
| Keywords | Antimicrobial;Chitin-binding;Disulfide bond;Fungicide;Hydrolase;Nuclease;Pathogenesis-related protein;Plant defense;Reference proteome;Signal;Vacuole |
| Interact With | |
| Induction | INDUCTION: Up-regulated by ethylene, methyl jasmonate, wounding and virus infection. Weakly induced by salicylic acid and 2,6-dichlorisonicotinic acid. {ECO:0000269|PubMed:21193575, ECO:0000269|PubMed:8118053}. |
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole {ECO:0000269|PubMed:22868784}. Note=associated with the tonoplast. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10594097; 10608663; 11161023; 11971137; 12668776; 12694595; 12805630; 16941900; 17189328; 17419843; 17916636; 17931347; 17956859; 18203731; 18467450; 18533832; 18650403; 18708476; 18944225; 19000166; 19054360; 19251652; 19857612; 20192832; 20484005; 20950893; 21453430; 22564282; 22731664; 23234406; 23448426; 23460952; 25244063; 25261123; 25288948; 25643917; 26038230; 26304848; 27247031; 28627464; 28724081; 29149328; 29490615; 31087367; 31611892; 32732351; 9844023; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,937 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |