| IED ID | IndEnz0009000144 |
| Enzyme Type ID | chitinase000144 |
| Protein Name |
Lysozyme A EC 3.2.1.n3 1,4-beta-N-acetylmuramidase A |
| Gene Name | alyA DDB_G0275123 |
| Organism | Dictyostelium discoideum (Slime mold) |
| Taxonomic Lineage | cellular organisms Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia (dictyostelid cellular slime molds) Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) |
| Enzyme Sequence | MRIAFFLLVLAVIIGFAYGYSCPKPCYGNMCCSTSPNNQYYLTDFCGSTSACGPVPSCSGALYFTADSQRFGCGKYLNLCRSGKCVKAQIYDAGPAMWVEQDAGMMIIDASPTICHVLTGGSSCGWSDHFLITATVTSLTDSRPLGPFNVTESEMAQLFIDHEIAMAQCEAEKTCNGFDLE |
| Enzyme Length | 181 |
| Uniprot Accession Number | Q8T1G4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan.; EC=3.2.1.n3; Evidence={ECO:0000269|PubMed:15640146}; |
| DNA Binding | |
| EC Number | 3.2.1.n3 |
| Enzyme Function | FUNCTION: Has antibacterial activity against the Gram-positive bacteria B.subtilis, B.megaterium and M.luteus. No antibacterial activity detected against the Gram-positive bacterium S.aureus or against the Gram-negative bacterium E.coli. Lacks chitinase activity. {ECO:0000269|PubMed:15640146}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Stable when incubated at 50 degrees Celsius for 10 minutes at pH 5.5. Activity decreases by 50% when incubated at 60 degrees Celsius for 10 minutes at pH 5.5. {ECO:0000269|PubMed:15640146}; |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Propeptide (1); Signal peptide (1) |
| Keywords | Antibiotic;Antimicrobial;Bacteriolytic enzyme;Cytoplasmic vesicle;Direct protein sequencing;Disulfide bond;Glycosidase;Hydrolase;Reference proteome;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasmic vesicle lumen {ECO:0000269|PubMed:15640146}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains six disulfide bonds. {ECO:0000269|PubMed:15640146, ECO:0000305}. |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000269|PubMed:15640146 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18339368; 18559084; 18590548; 19081545; 21056680; 24161926; 24628900; |
| Motif | |
| Gene Encoded By | |
| Mass | 19,526 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |