| IED ID | IndEnz0009000152 |
| Enzyme Type ID | chitinase000152 |
| Protein Name |
Putative type II secretion system protein I T2SS minor pseudopilin I Putative general secretion pathway protein I |
| Gene Name | gspI yheH b3330 JW5706 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MNKQSGMTLLEVLLAMSIFTAVALTLMSSMQGQRNAIERMRNETLALWIADNQLQSQDSFGEENTSSSGKELINGEEWNWRSDIHSSKDGTLLERTITVTLPSGQTTSLTRYQSIDNKSGQAQDD |
| Enzyme Length | 125 |
| Uniprot Accession Number | P45760 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the type II secretion system required for the energy-dependent secretion of extracellular factors such as proteases and toxins from the periplasm. Part of the pseudopilus tip complex that is critical for the recognition and binding of secretion substrates. {ECO:0000250|UniProtKB:Q00516}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous initiation (1); Modified residue (1); Propeptide (1); Transmembrane (1) |
| Keywords | Cell inner membrane;Cell membrane;Membrane;Methylation;Protein transport;Reference proteome;Transmembrane;Transmembrane helix;Transport |
| Interact With | |
| Induction | INDUCTION: Silenced by the DNA-binding protein H-NS under standard growth conditions. {ECO:0000269|PubMed:11118204}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000250|UniProtKB:Q00516}; Single-pass membrane protein {ECO:0000255}. |
| Modified Residue | MOD_RES 7; /note=N-methylmethionine; /evidence=ECO:0000255|PROSITE-ProRule:PRU01070 |
| Post Translational Modification | PTM: Cleaved by prepilin peptidase. {ECO:0000250|UniProtKB:Q00516}.; PTM: Methylated by prepilin peptidase at the amino group of the N-terminal methionine once the leader sequence is cleaved by prepilin peptidase. {ECO:0000250|UniProtKB:Q00516}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 13,901 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |