IED ID | IndEnz0009000152 |
Enzyme Type ID | chitinase000152 |
Protein Name |
Putative type II secretion system protein I T2SS minor pseudopilin I Putative general secretion pathway protein I |
Gene Name | gspI yheH b3330 JW5706 |
Organism | Escherichia coli (strain K12) |
Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
Enzyme Sequence | MNKQSGMTLLEVLLAMSIFTAVALTLMSSMQGQRNAIERMRNETLALWIADNQLQSQDSFGEENTSSSGKELINGEEWNWRSDIHSSKDGTLLERTITVTLPSGQTTSLTRYQSIDNKSGQAQDD |
Enzyme Length | 125 |
Uniprot Accession Number | P45760 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Component of the type II secretion system required for the energy-dependent secretion of extracellular factors such as proteases and toxins from the periplasm. Part of the pseudopilus tip complex that is critical for the recognition and binding of secretion substrates. {ECO:0000250|UniProtKB:Q00516}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Erroneous initiation (1); Modified residue (1); Propeptide (1); Transmembrane (1) |
Keywords | Cell inner membrane;Cell membrane;Membrane;Methylation;Protein transport;Reference proteome;Transmembrane;Transmembrane helix;Transport |
Interact With | |
Induction | INDUCTION: Silenced by the DNA-binding protein H-NS under standard growth conditions. {ECO:0000269|PubMed:11118204}. |
Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000250|UniProtKB:Q00516}; Single-pass membrane protein {ECO:0000255}. |
Modified Residue | MOD_RES 7; /note=N-methylmethionine; /evidence=ECO:0000255|PROSITE-ProRule:PRU01070 |
Post Translational Modification | PTM: Cleaved by prepilin peptidase. {ECO:0000250|UniProtKB:Q00516}.; PTM: Methylated by prepilin peptidase at the amino group of the N-terminal methionine once the leader sequence is cleaved by prepilin peptidase. {ECO:0000250|UniProtKB:Q00516}. |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 13,901 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |