Detail Information for IndEnz0009000155
IED ID IndEnz0009000155
Enzyme Type ID chitinase000155
Protein Name Highly immunogenic outer capsid protein
Hoc
Gene Name hoc
Organism Enterobacteria phage T4 (Bacteriophage T4)
Taxonomic Lineage Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Tevenvirinae Tequatrovirus Enterobacteria phage T4 (Bacteriophage T4)
Enzyme Sequence MTFTVDITPKTPTGVIDETKQFTATPSGQTGGGTITYAWSVDNVPQDGAEATFSYVLKGPAGQKTIKVVATNTLSEGGPETAEATTTITVKNKTQTTTLAVTPASPAAGVIGTPVQFTAALASQPDGASATYQWYVDDSQVGGETNSTFSYTPTTSGVKRIKCVAQVTATDYDALSVTSNEVSLTVNKKTMNPQVTLTPPSINVQQDASATFTANVTGAPEEAQITYSWKKDSSPVEGSTNVYTVDTSSVGSQTIEVTATVTAADYNPVTVTKTGNVTVTAKVAPEPEGELPYVHPLPHRSSAYIWCGWWVMDEIQKMTEEGKDWKTDDPDSKYYLHRYTLQKMMKDYPEVDVQESRNGYIIHKTALETGIIYTYP
Enzyme Length 376
Uniprot Accession Number P18056
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Capsid decoration protein that binds as a monomer at the center of each major capsid protein hexamer once maturation and expension of the capsid has occured. It only has a marginal effect on head stability. Dispensable for the head morphogenesis and phage infection. {ECO:0000255|HAMAP-Rule:MF_04116, ECO:0000269|PubMed:11162794, ECO:0000269|PubMed:1469720, ECO:0000269|PubMed:15071181}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Helix (1); Region (1); Turn (1)
Keywords 3D-structure;Capsid protein;Reference proteome;Virion
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Virion {ECO:0000255|HAMAP-Rule:MF_04116, ECO:0000269|PubMed:11162794, ECO:0000269|PubMed:15071181}. Note=The Hoc protein is the most prominent feature at the virion surface. There are 155 copies on the capsid. {ECO:0000269|PubMed:15071181}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D Electron microscopy (1)
Cross Reference PDB 5VF3;
Mapped Pubmed ID 28893988;
Motif
Gene Encoded By
Mass 40,387
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda