| IED ID | IndEnz0009000173 |
| Enzyme Type ID | chitinase000173 |
| Protein Name |
Putative type II secretion system protein L T2SS protein L Putative general secretion pathway protein L |
| Gene Name | gspL yheK b3333 JW5705 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MPESLMVIRSSSTLRKHWEWMTFSADSVSSVHTLTDDLPLESLADQPGAGNVHLLIPPEGLLYRSLTLPNAKYKLTAQTLQWLAEETLPDNTQDWHWTVVDKQNESVEVIGIQSEKLSRYLERLHTAGLNVTRVLPDGCYLPWEVDSWTLVNQQTSWLIRSAAHAFNELDEHWLQHLAAQFPPENMLCYGVVPHGVAAANPLIQHPEIPSLSLYSADIAFQRYDMLHGIFRKQKTVSKSGKWLARLAVSCLVLAILSFVGSRSIALWHTLKIEDQLQQQQQETWQRYFPQIKRTHNFRFYFKQQLAQQYPEAVPLLYHLQTLLLEHPELQLMEANYSQKQKSLTLKMSAKSEANIDRFCELTQSWLPMEKTEKDPVSGVWTVRNSGK |
| Enzyme Length | 387 |
| Uniprot Accession Number | P45763 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inner membrane component of the type II secretion system required for the energy-dependent secretion of extracellular factors such as proteases and toxins from the periplasm. Plays a role in the complex assembly and recruits GspM resulting in a stable complex in the inner membrane. Provides thus a link between the energy-providing GspE protein in the cytoplasm and the rest of the T2SS machinery. {ECO:0000250|UniProtKB:P25060}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous initiation (1); Topological domain (2); Transmembrane (1) |
| Keywords | Cell inner membrane;Cell membrane;Membrane;Protein transport;Reference proteome;Transmembrane;Transmembrane helix;Transport |
| Interact With | |
| Induction | INDUCTION: Silenced by the DNA-binding protein H-NS under standard growth conditions. {ECO:0000269|PubMed:11118204}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000250|UniProtKB:P25060}; Single-pass membrane protein {ECO:0000250|UniProtKB:P25060}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 44,540 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |