IED ID | IndEnz0009000173 |
Enzyme Type ID | chitinase000173 |
Protein Name |
Putative type II secretion system protein L T2SS protein L Putative general secretion pathway protein L |
Gene Name | gspL yheK b3333 JW5705 |
Organism | Escherichia coli (strain K12) |
Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
Enzyme Sequence | MPESLMVIRSSSTLRKHWEWMTFSADSVSSVHTLTDDLPLESLADQPGAGNVHLLIPPEGLLYRSLTLPNAKYKLTAQTLQWLAEETLPDNTQDWHWTVVDKQNESVEVIGIQSEKLSRYLERLHTAGLNVTRVLPDGCYLPWEVDSWTLVNQQTSWLIRSAAHAFNELDEHWLQHLAAQFPPENMLCYGVVPHGVAAANPLIQHPEIPSLSLYSADIAFQRYDMLHGIFRKQKTVSKSGKWLARLAVSCLVLAILSFVGSRSIALWHTLKIEDQLQQQQQETWQRYFPQIKRTHNFRFYFKQQLAQQYPEAVPLLYHLQTLLLEHPELQLMEANYSQKQKSLTLKMSAKSEANIDRFCELTQSWLPMEKTEKDPVSGVWTVRNSGK |
Enzyme Length | 387 |
Uniprot Accession Number | P45763 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Inner membrane component of the type II secretion system required for the energy-dependent secretion of extracellular factors such as proteases and toxins from the periplasm. Plays a role in the complex assembly and recruits GspM resulting in a stable complex in the inner membrane. Provides thus a link between the energy-providing GspE protein in the cytoplasm and the rest of the T2SS machinery. {ECO:0000250|UniProtKB:P25060}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Erroneous initiation (1); Topological domain (2); Transmembrane (1) |
Keywords | Cell inner membrane;Cell membrane;Membrane;Protein transport;Reference proteome;Transmembrane;Transmembrane helix;Transport |
Interact With | |
Induction | INDUCTION: Silenced by the DNA-binding protein H-NS under standard growth conditions. {ECO:0000269|PubMed:11118204}. |
Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000250|UniProtKB:P25060}; Single-pass membrane protein {ECO:0000250|UniProtKB:P25060}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 44,540 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |