| IED ID |
IndEnz0009000174 |
| Enzyme Type ID |
chitinase000174 |
| Protein Name |
Diacetylchitobiose uptake system permease protein DasC
|
| Gene Name |
dasC SCO5234 |
| Organism |
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Streptomycetales
Streptomycetaceae
Streptomyces
Streptomyces albidoflavus group
Streptomyces coelicolor
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
|
| Enzyme Sequence |
MKRSLFGRVWPNVTAVVLFIGLVFPVYWMFATAFKPTGDIISENPVWFPTDITFEHFKTATEADHFWTYVSNSLIVTVCAVVFSLVIALAGSFALARMRFKGRRGFIVGFMLAQMAPWEVMVIAIYMIVRDASMLNSLVPLTLFYMMMILPFTILTLRGFVAAVPKELEESAMVDGCTRAQAFRRVILPLLAPGLMSTSMFGFITAWNELPLVLVVNKEAESQTLPLWLTSFQTVFGDNWGATMAASSLFAIPILILFVYLQRKAVSGLTAGAVKG |
| Enzyme Length |
276 |
| Uniprot Accession Number |
Q9K489 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Part of the ABC transporter complex DasABC-MsiK involved in N,N'-diacetylchitobiose ((GlcNAc)2) uptake. Responsible for the translocation of the substrate across the membrane. {ECO:0000305|PubMed:17351098}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Domain (1); Transmembrane (6) |
| Keywords |
Cell membrane;Membrane;Reference proteome;Sugar transport;Transmembrane;Transmembrane helix;Transport |
| Interact With |
|
| Induction |
INDUCTION: Induced by (GlcNAc)2 and (GlcNAc)3. {ECO:0000269|PubMed:17351098}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
30,681 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|