| IED ID | IndEnz0009000199 |
| Enzyme Type ID | chitinase000199 |
| Protein Name |
Endochitinase 1 EC 3.2.1.14 Fragments |
| Gene Name | |
| Organism | Capsicum chinense (Scotch bonnet) (Bonnet pepper) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Capsiceae Capsicum (peppers) Capsicum chinense (Scotch bonnet) (Bonnet pepper) |
| Enzyme Sequence | NNFYSYNAFITAAKSFPGFGTTGDTAVRGPIQISYNYNYGPCGR |
| Enzyme Length | 44 |
| Uniprot Accession Number | P86081 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; Evidence={ECO:0000250|UniProtKB:P24091}; |
| DNA Binding | |
| EC Number | 3.2.1.14 |
| Enzyme Function | FUNCTION: Defense against chitin-containing fungal pathogens. {ECO:0000305}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (1); Non-terminal residue (2); Sequence uncertainty (9) |
| Keywords | Carbohydrate metabolism;Chitin degradation;Direct protein sequencing;Glycosidase;Hydrolase;Hydroxylation;Plant defense;Polysaccharide degradation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,802 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |