| IED ID | IndEnz0009000214 |
| Enzyme Type ID | chitinase000214 |
| Protein Name |
Acidic endochitinase EC 3.2.1.14 |
| Gene Name | |
| Organism | Cucumis sativus (Cucumber) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Cucurbitales Cucurbitaceae Benincaseae Cucumis Cucumis sativus (Cucumber) |
| Enzyme Sequence | MAAHKITTTLSIFFLLSSIFRSSDAAGIAIYWGQNGNEGSLASTCATGNYEFVNIAFLSSFGSGQAPVLNLAGHCNPDNNGCAFLSDEINSCKSQNVKVLLSIGGGAGSYSLSSADDAKQVANFIWNSYLGGQSDSRPLGAAVLDGVDFDIESGSGQFWDVLAQELKNFGQVILSAAPQCPIPDAHLDAAIKTGLFDSVWVQFYNNPPCMFADNADNLLSSWNQWTAFPTSKLYMGLPAAREAAPSGGFIPADVLISQVLPTIKASSNYGGVMLWSKAFDNGYSDSIKGSIG |
| Enzyme Length | 292 |
| Uniprot Accession Number | P17541 |
| Absorption | |
| Active Site | ACT_SITE 152; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; |
| DNA Binding | |
| EC Number | 3.2.1.14 |
| Enzyme Function | FUNCTION: This protein functions as a defense against chitin containing fungal pathogens. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Chitin degradation;Direct protein sequencing;Disulfide bond;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: By salicylate and upon tobacco necrosis virus infection. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..25 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,774 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |