| IED ID | IndEnz0009000215 |
| Enzyme Type ID | chitinase000215 |
| Protein Name |
Chitinase EC 3.2.1.14 EfChi18A |
| Gene Name | EF_0361 |
| Organism | Enterococcus faecalis (strain ATCC 700802 / V583) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Lactobacillales Enterococcaceae Enterococcus Enterococcus faecalis (Streptococcus faecalis) Enterococcus faecalis (strain ATCC 700802 / V583) |
| Enzyme Sequence | MKLKKIIPAFPLLSTVAVGLWLTPTQASADAADTMVDISGKKVLVGYWHNWASKGRDGYKQGTSASLNLSEVNQAYNVVPVSFMKSDGTTRIPTFKPYNQTDTAFRQEVAQLNSQGRAVLLALGGADAHIQLVKGDEQAFANEIIRQVETYGFDGLDIDLEQLAITAGDNQTVIPATLKIVKDHYRAQGKNFIITMAPEFPYLKPGAAYETYITSLNGYYDYIAPQLYNQGGDGVWVDEIMTWVAQSNDALKYEFLYYMSDSLIHGTRGYLQIPNDKLVLGLPANRDAAGSGYVVEATPVAKTFDQLAKDGNPIRGLMTWSANWDVGQDVNGKSYNNEFATRYSNLVK |
| Enzyme Length | 348 |
| Uniprot Accession Number | Q838S2 |
| Absorption | |
| Active Site | ACT_SITE 161; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; Evidence={ECO:0000269|PubMed:22210154}; |
| DNA Binding | |
| EC Number | 3.2.1.14 |
| Enzyme Function | FUNCTION: Involved in chitin degradation. Catalyzes the cleavage of glycosidic linkages in chitooligosaccharides and in alpha- and beta-chitin. Its activity on chitooligosaccharides increases considerably with degrees of polymerization (the initial rate of hydrolysis for GlcNAc5 is about 130-fold higher than that for GlcNAc3). Its activity is greatly stimulated in the presence of the lytic chitin monooxygenase EfCBM33A, which attacks the crystalline structure of chitin and makes the polymer more accessible to the chitinase; combining the two enzymes leads to rapid and complete depolymerization of crystalline chitin, especially with beta-chitin as a substrate. Is likely involved in a chitin degradation pathway that allows E.faecalis V583 to grow on chitin as a carbon source. {ECO:0000269|PubMed:22210154}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Glycan degradation; chitin degradation. {ECO:0000269|PubMed:22210154}. |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Chitin degradation;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:22210154}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..29; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,339 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |