| IED ID | IndEnz0009000228 |
| Enzyme Type ID | chitinase000228 |
| Protein Name |
Acidic endochitinase WIN6.2C EC 3.2.1.14 Fragment |
| Gene Name | |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Salicaceae Saliceae Populus (poplars) Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Enzyme Sequence | MSVWAFFAFFSLFLSLSVRGSAEQCGRQAGDALCPGGLCCSFYGWCGTTVDYCGDGCQSQCDGGDGCDGGGGGGGDGDDGYLSDIIPKSTFDALLKFRNDPRCHAVGFYTYDAFISAAKEF |
| Enzyme Length | 121 |
| Uniprot Accession Number | P29032 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; |
| DNA Binding | |
| EC Number | 3.2.1.14 |
| Enzyme Function | FUNCTION: Defense against chitin-containing fungal pathogens. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (4); Domain (1); Non-terminal residue (1); Region (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Chitin degradation;Chitin-binding;Disulfide bond;Glycosidase;Hydrolase;Plant defense;Polysaccharide degradation;Reference proteome;Signal |
| Interact With | |
| Induction | INDUCTION: By wounding. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,689 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |