| IED ID | IndEnz0009000236 |
| Enzyme Type ID | chitinase000236 |
| Protein Name |
Endochitinase 2 CHIT 2 EC 3.2.1.14 Fragment |
| Gene Name | |
| Organism | Arachis hypogaea (Peanut) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade dalbergioids sensu lato Dalbergieae Pterocarpus clade Arachis Arachis hypogaea (Peanut) |
| Enzyme Sequence | MTEQKPKPSCHNVMVGNYVPTASDRAANRTLGFGLVTNIINGGLDC |
| Enzyme Length | 46 |
| Uniprot Accession Number | Q06014 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; |
| DNA Binding | |
| EC Number | 3.2.1.14 |
| Enzyme Function | FUNCTION: Defense against chitin-containing fungal and bacterial pathogens. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (2) |
| Keywords | Carbohydrate metabolism;Chitin degradation;Chitin-binding;Glycosidase;Hydrolase;Plant defense;Polysaccharide degradation |
| Interact With | |
| Induction | INDUCTION: By glucan and P.megasperma elicitors. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,892 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |