| IED ID | IndEnz0009000240 |
| Enzyme Type ID | chitinase000240 |
| Protein Name |
Candidate secreted effector protein MPL124478 CSEP MPL124478 Small secreted protein MPL124478 SSP MPL124478 |
| Gene Name | MELLADRAFT_124478 MPL124478 |
| Organism | Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) (Poplar leaf rust fungus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Pucciniomycotina Pucciniomycetes Pucciniales (rusts) Melampsoraceae Melampsora Melampsora larici-populina Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) (Poplar leaf rust fungus) |
| Enzyme Sequence | MMSQRYFKLLVVFLGLFAMIASIAEGKGRHKNGGGSRKKTNTVNNGGNNGGKPKVPMCGTTAATCSKGSPSCKGGKPTCGSKGAFNACGGNVKVTC |
| Enzyme Length | 96 |
| Uniprot Accession Number | F4RBY2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Rust effector delivered into infected tissues to modulate host functions and contribute to pathogen virulence (PubMed:30283062). Binds the TGA1a-binding DNA sequence to repress the expression of genes involved in immune responses such as the defense-related transcription factors WRKY18, WRKY27, WRKY33, MYB51, the defense-related proteins NHL3, RPP8, YLS9, AZI1, CRK11 and the jasmonate pathway and regulation genes JAZ1, ASA1, ASB1. Other genes involved in diverse mechanisms also down-regulated include the chitinase CHI, the brassinosteroid-related genes BAS1, BES1 PAR1, BEE1, the salicylic acid-related gene NPR3, the ethylene-related response genes ARGOS and ARGOS-like (ARL), EBF2, ERF6, ETR2, RTE1, the carbon metabolism-related gene EXO, as well as the red/far red light signalization-related genes FAR1, GA2OX2, PAR1, PIF3, PKS4 (PubMed:30283062). {ECO:0000269|PubMed:30283062}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Mutagenesis (1); Region (2); Signal peptide (1) |
| Keywords | Host nucleus;Reference proteome;Secreted;Signal;Virulence |
| Interact With | |
| Induction | INDUCTION: Expressed during host infection. {ECO:0000269|PubMed:21644839}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:25650830, ECO:0000269|PubMed:30283062}. Host nucleus {ECO:0000269|PubMed:25650830, ECO:0000269|PubMed:30283062}. Host nucleus, host nucleolus {ECO:0000269|PubMed:25650830, ECO:0000269|PubMed:30283062}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,731 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |