Detail Information for IndEnz0009000277
IED ID IndEnz0009000277
Enzyme Type ID chitinase000277
Protein Name Chitinase-like protein Idgf3
Imaginal disk growth factor protein 3
Gene Name Idgf3
Organism Drosophila simulans (Fruit fly)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila simulans (Fruit fly)
Enzyme Sequence MSGSLWLSLALSLAVLAQFKVSAAPNLVCFYDSQGSQRQGLAQFSITDIELALQFCTHLVYGYAGVNADNFEMQSINKRLDLEQRHLAQVTSMKERYPHIKFLLSVGGDADTNEGNQYIKLLESGQQGHRRFIESARDLVRRYNFDGLDLALQLPRNKPRKVHGDVGSAWKSFKKFFTGDYIVDTESETHKGQVTALIKDLSAALKQNDLLLSLTVLPNVNSSWYYDAPSIAPSLDFINLGTFDFLTPQRNPEEADFSAPTYEAVGQNRLGHYNLNFQMEHWLLQRVPANKINIGIATYGRTWKMSKDSGDSGMPVVSSTQGPAPAGPQSKQEGLLNWAEICSLMPNPSNSNARGPNAPVKRVVDPTKRYGSYAFRAADENGDHGLWISYDDPDSGSSKAMYARARNLGGVALFDLTQDDFRGQCTGDRFPMLRAIKYRLL
Enzyme Length 441
Uniprot Accession Number Q8MX32
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Cooperates with insulin-like peptides to stimulate the proliferation, polarization and motility of imaginal disk cells. May act by stabilizing the binding of insulin-like peptides to its receptor through a simultaneous interaction with both molecules to form a multiprotein signaling complex (By similarity). {ECO:0000250}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Compositional bias (1); Disulfide bond (2); Domain (1); Glycosylation (1); Region (1); Signal peptide (1)
Keywords Developmental protein;Disulfide bond;Glycoprotein;Secreted;Signal
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000250}. Note=Secreted in hemolymph. It is probably transported to target tissues via hemolymph. {ECO:0000250}.
Modified Residue
Post Translational Modification PTM: Glycosylated. {ECO:0000250}.
Signal Peptide SIGNAL 1..23; /evidence=ECO:0000250
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 49,080
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda