| IED ID | IndEnz0009000284 |
| Enzyme Type ID | chitinase000284 |
| Protein Name |
Chitinase-like protein Imaginal disk growth factor protein Fragments |
| Gene Name | |
| Organism | Heliothis virescens (Tobacco budworm moth) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Amphiesmenoptera Lepidoptera (butterflies and moths) Glossata Neolepidoptera Heteroneura Ditrysia Obtectomera Noctuoidea Noctuidae (owlet moths) Heliothinae Heliothis Heliothis virescens (Tobacco budworm moth) |
| Enzyme Sequence | VLLSVGGDADTESPEKKNLGGVSIVDLSMDDFRGLLT |
| Enzyme Length | 37 |
| Uniprot Accession Number | P86357 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cooperates with insulin-like peptides to stimulate the proliferation, polarization and motility of imaginal disk cells. May act by stabilizing the binding of insulin-like peptides to its receptor through a simultaneous interaction with both molecules to form a multiprotein signaling complex (By similarity). {ECO:0000250|UniProtKB:Q9W303}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Non-adjacent residues (1); Non-terminal residue (2); Region (1) |
| Keywords | Developmental protein;Direct protein sequencing;Glycoprotein;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q9W303}. Note=Secreted in hemolymph. It is probably transported to target tissues via hemolymph. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated. {ECO:0000250|UniProtKB:Q23997}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,849 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |