| IED ID | IndEnz0009000292 |
| Enzyme Type ID | chitinase000292 |
| Protein Name |
Class III chitinase ARB_03514 EC 3.2.1.14 Endochitinase ARB_03514 |
| Gene Name | ARB_03514 |
| Organism | Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Onygenales Arthrodermataceae (dermatophytes) Trichophyton Arthroderma benhamiae (Trichophyton mentagrophytes) Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes) |
| Enzyme Sequence | MSSVKNILSFVALFAGVKTAYAGLNSPGHNNVAIYWGADVDVIPLAFAVSIKGPGGVPQINFSNQGDPCKPFPGTDLLHCPQIGEDIKTCQKKGKTILLSIGGATYSEGGFRSAEDAVAGANLLWDTFGPVKSSNSSVLRPFDDAVIDGFDLDFEATVLNMVPFAKQLRTLYDAEKSKTFYLTAAPQCPYPDLYNKEMLEGGVKFDALFIQFYNNFCGLNNFVLGSQSQDKFNFAEWDNFAKKVSANPDVKIMVGAPANKGAASSGYIDAQTLVSVINWSKTFSSFGGVMMWDASQAWANGNFTSAVKGALSAGNSRVVRMSYAGYHSGY |
| Enzyme Length | 330 |
| Uniprot Accession Number | D4B4X4 |
| Absorption | |
| Active Site | ACT_SITE 155; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; Evidence={ECO:0000250|UniProtKB:Q12713}; |
| DNA Binding | |
| EC Number | 3.2.1.14 |
| Enzyme Function | FUNCTION: Secreted chitinase involved in the degradation of chitin, a component of the cell walls of fungi and exoskeletal elements of some animals (including worms and arthropods) (By similarity). Plays a morphogenetic role during apical growth, cell division and differentiation (cell wall morphogenesis) (By similarity). {ECO:0000250|UniProtKB:Q12713}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Erroneous gene model prediction (1); Glycosylation (4); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Chitin degradation;Chitin-binding;Glycoprotein;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:21919205}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,423 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |