IED ID | IndEnz0009000304 |
Enzyme Type ID | chitinase000304 |
Protein Name |
Protein PROPEP890 GmPROPEP890 Cleaved into: Peptide GmPep890 |
Gene Name | PROPEP890 Glyma09g36370 |
Organism | Glycine max (Soybean) (Glycine hispida) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen. Soja Glycine max (Soybean) (Glycine hispida) |
Enzyme Sequence | MVSCFDFFLSLNFGKMAKRFVWRTDKPQADLPQTPNSQVRIVSRDLPRGGNY |
Enzyme Length | 52 |
Uniprot Accession Number | K7LFJ0 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: [Peptide GmPep890]: Produces a rapid alkalinization of the cellular media and the induction of defense-related genes, including chitinase 1b, chalcone synthase and CYP93A1. Not active in tobacco or Arabidopsis. The receptor for GmPep890 is probably different from the receptor for GmSubPep. {ECO:0000269|PubMed:21478368}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Peptide (1); Region (1) |
Keywords | Plant defense;Reference proteome |
Interact With | |
Induction | INDUCTION: Up-regulated by the GmPep890 peptide and methyl salicylate. No induction by methyl jasmonate. {ECO:0000269|PubMed:21478368}. |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 6,036 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |