| IED ID | IndEnz0009000308 |
| Enzyme Type ID | chitinase000308 |
| Protein Name |
Endochitinase 33 EC 3.2.1.14 33 kDa endochitinase Chitinase 33 |
| Gene Name | chit33 |
| Organism | Trichoderma harzianum (Hypocrea lixii) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Hypocreaceae Trichoderma Trichoderma harzianum (Hypocrea lixii) |
| Enzyme Sequence | MPSLTALASLLALVPSALAGWNVNSKQNIAVYWGQNSANSQSTQQRLSFYCNDANINVIDIAFLNGITPPMTNFANAGDRCTPFSDNPWLLQCPEIEADIKTCQANGKTILLSLGGDSYTQGGWSSTGAAQSAADQVWAMFGPVQSGSSVHRPFGSAVVDGFDFDFEATTNNLAAFGAQLKSRTNAAGGKKYYFSAAPQCFFPDAAVGALINAVPMDWIQIQFYNNPCGVSGFTPGTSTQNNYNYQTWENWAKTSPNPNVKLLVGIPAGPGAGRGYVSGSQLTSVFQYSKGFSTFAGAMMWDMSQLYQNTGFETQVVNALR |
| Enzyme Length | 321 |
| Uniprot Accession Number | Q12713 |
| Absorption | |
| Active Site | ACT_SITE 167; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.; EC=3.2.1.14; Evidence={ECO:0000269|PubMed:1606968}; |
| DNA Binding | |
| EC Number | 3.2.1.14 |
| Enzyme Function | FUNCTION: Secreted chitinase involved in the degradation of chitin, a component of the cell walls of fungi and exoskeletal elements of some animals (including worms and arthropods). Plays a morphogenetic role during apical growth, cell division and differentiation (cell wall morphogenesis). May be involved in the degradation and further assimilation of phytopathogenic fungi, namely mycoparasitism, the major mechanism accounting for the antagonistic activity against phytopathogenic fungi displayed by Trichoderma. {ECO:0000269|PubMed:1606968}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 40-45 degrees Celsius. {ECO:0000269|PubMed:1606968}; |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Chitin degradation;Chitin-binding;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted;Signal;Virulence |
| Interact With | |
| Induction | INDUCTION: Specifically induced by chitin and strongly repressed by glucose. {ECO:0000269|PubMed:1606968, ECO:0000269|PubMed:8575023}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:1606968}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 34,348 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.0 mg/ml for colloidal chitin {ECO:0000269|PubMed:1606968}; KM=0.85 mM for p-nitrophenyl-N-N'-diacetylchitobiose {ECO:0000269|PubMed:1606968}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.2.1.14; |