| IED ID | IndEnz0009000311 |
| Enzyme Type ID | chitinase000311 |
| Protein Name |
Diacetylchitobiose uptake system ATP-binding protein MsiK EC 7.5.2.- |
| Gene Name | msiK SCO4240 |
| Organism | Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces albidoflavus group Streptomyces coelicolor Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
| Enzyme Sequence | MATVTFDKATRVYPGSTKPAVDGLDIDIADGEFLVLVGPSGCGKSTSLRMLAGLEDVNGGAIRIGDRDVTHLPPKDRDIAMVFQNYALYPHMSVADNMGFALKIAGVNKAEIRQKVEEAAKILDLTEYLDRKPKALSGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIASLQRRLGITTVYVTHDQVEAMTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGSPAMNLVEVPITDGGVKFGNSVVPVNRDALKAASDKGDRTVTVGVRPEHFDVVELNGGAAKTLSKDSADAPAGLAVSVNVVEETGADGYIYGTVEVGGETKDLVVRVSSRAVPEKGATVHVVPRPGEIHVFSSSTGERLTD |
| Enzyme Length | 378 |
| Uniprot Accession Number | Q9L0Q1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 7.5.2.- |
| Enzyme Function | FUNCTION: Part of the ABC transporter complexes DasABC-MsiK and NgcEFG-MsiK involved in N,N'-diacetylchitobiose ((GlcNAc)2) uptake. Responsible for energy coupling to the transport system. {ECO:0000269|PubMed:18957589, ECO:0000269|PubMed:30089751}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 38..45; /note=ATP; /evidence=ECO:0000255|PROSITE-ProRule:PRU00434 |
| Features | Chain (1); Domain (1); Nucleotide binding (1) |
| Keywords | ATP-binding;Cell membrane;Membrane;Nucleotide-binding;Reference proteome;Sugar transport;Translocase;Transport |
| Interact With | |
| Induction | INDUCTION: Constitutively expressed. {ECO:0000269|PubMed:18957589}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Peripheral membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 40,396 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |