| IED ID |
IndEnz0009000318 |
| Enzyme Type ID |
chitinase000318 |
| Protein Name |
HTH-type transcriptional regulator reg1
|
| Gene Name |
reg1 |
| Organism |
Streptomyces lividans |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Streptomycetales
Streptomycetaceae
Streptomyces
Streptomyces lividans
|
| Enzyme Sequence |
MTTRLADIAAQAGVSEATVSRVLNGKPGVAATTRQSVLAALDVLGYERPVRLRRRSAGLVGLVTPELENPIFPAFAQVIGQALTRQGYTPVLATQTPGGSTEDELTEMLVDRGVAGIIYVSGLHADTTADMQRYERLGGRGVPFVLVDGFSSQVQAPFISPDDRAAMSLAVTHLVSLGHTRIGLALGPKRFVPVQRKIEGFVRTVQEPVGAERRSTVEKELVQHSLYTLEGGQAAASALIGRDCTAVVCASDMMALGAIRAARQLGLDVPKDVSVVGFDDSPLIAFTDPPLTTVRKPVPAMGQAAVRTLLEEIGGTPAPHSEFVFMPELVVRGSTASAPGERGRP |
| Enzyme Length |
345 |
| Uniprot Accession Number |
P72469 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
DNA_BIND 5..24; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00111 |
| EC Number |
|
| Enzyme Function |
FUNCTION: Transcription repressor involved in control of expression of alpha-amylase and chitinase genes and of actinorhodin production. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); DNA binding (1); Domain (1) |
| Keywords |
DNA-binding;Repressor;Transcription;Transcription regulation |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
36,424 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|