| IED ID | IndEnz0009000349 |
| Enzyme Type ID | chitinase000349 |
| Protein Name |
Protein PROPEP914 GmPROPEP914 Cleaved into: Peptide GmPep914 |
| Gene Name | PROPEP914 Glyma12g00991 |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen. Soja Glycine max (Soybean) (Glycine hispida) |
| Enzyme Sequence | MVKCFDFFLSLNFGKMTKLLVWRTDKPQDDMPQTPNSQVTIVSRDHPRGGNY |
| Enzyme Length | 52 |
| Uniprot Accession Number | K7LSB9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Peptide GmPep914]: Produces a rapid alkalinization of the cellular media and the induction of defense-related genes, including chitinase 1b, chalcone synthase and CYP93A1. Not active in tobacco or Arabidopsis. The receptor for GmPep914 is probably different from the receptor for GmSubPep. {ECO:0000269|PubMed:21478368}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Mutagenesis (8); Peptide (1); Region (1) |
| Keywords | Plant defense;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Up-regulated by the GmPep914 peptide, ethephon, methyl jasmonate and methyl salicylate. {ECO:0000269|PubMed:21478368}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,061 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |