| IED ID | IndEnz0009000355 |
| Enzyme Type ID | chitinase000355 |
| Protein Name |
Xylanase inhibitor protein 1 XIP-1 XIP-I Class III chitinase homolog |
| Gene Name | XIPI |
| Organism | Triticum aestivum (Wheat) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Triticinae Triticum Triticum aestivum (Wheat) |
| Enzyme Sequence | MAPLAARRPACLLALLSVAAALFLTPTALAAGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA |
| Enzyme Length | 304 |
| Uniprot Accession Number | Q8L5C6 |
| Absorption | |
| Active Site | ACT_SITE 158; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Fungal xylanase inhibitor. Possesses competitive inhibiting activity against fungal endo-1,4-beta-D-xylanases belonging to glycoside hydrolase family 10 (GH10) and family 11 (GH11). Possesses also inhibitory activity towards barley alpha-amylases. Binding to xylanases or amylases is necessary for inhibition activity. May function in plant defense against secreted fungal pathogen xylanases. Is similar to class III chitinases, but does not exhibit chitinase activity. {ECO:0000269|PubMed:10024521, ECO:0000269|PubMed:11955286, ECO:0000269|PubMed:12023019, ECO:0000269|PubMed:12922177}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Beta strand (10); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (2); Helix (12); Region (2); Sequence conflict (2); Signal peptide (1); Turn (3) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Plant defense;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: By wounding, methyl jasmonate, and by E.graminis infection in leaves. {ECO:0000269|PubMed:15914935}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..30; /evidence="ECO:0000269|PubMed:10024521, ECO:0000269|PubMed:12023019" |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 1OM0; 1TA3; 1TE1; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 33,275 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |