| IED ID | IndEnz0010000028 |
| Enzyme Type ID | esterase000028 |
| Protein Name |
Esterase YbfF EC 3.1.-.- |
| Gene Name | ybfF b0686 JW0673 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNDHNIIQVDMRNHGLSPRDPVMNYPAMAQDLVDTLDAQQIDKATFIGHSMGGKAVMALTALASDRIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDAQTRQQAAAIMRQHLNEEGVIQFLLKSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPYVSEQYRDDLLAQFPQARAHVIAGAGHWVHAEKPDAVLRAIRRYLND |
| Enzyme Length | 254 |
| Uniprot Accession Number | P75736 |
| Absorption | |
| Active Site | ACT_SITE 89; /evidence=ECO:0000250; ACT_SITE 234; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: Displays esterase activity toward palmitoyl-CoA, malonyl-CoA and pNP-butyrate. {ECO:0000269|PubMed:15808744}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (8); Chain (1); Helix (13); Turn (3) |
| Keywords | 3D-structure;Hydrolase;Reference proteome;Serine esterase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 3BF7; 3BF8; |
| Mapped Pubmed ID | 16606699; 18215690; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,437 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.1.2.2; |