| IED ID | IndEnz0010000065 |
| Enzyme Type ID | esterase000065 |
| Protein Name |
Probable carboxylesterase Culp7 EC 3.1.1.- Cutinase-like protein 7 Culp7 |
| Gene Name | cut5b Rv3724B |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Enzyme Sequence | MAPGSHLVLAASEDCSSTHCVSQVGAKSLGVYAVNYPASNDFASSDFPKTVIDGIRDAGSHIQSMAMSCPQTRQVLGGYSQGAAVAGYVTSAVVPPAVPVQAVPAPMAPEVANHVAAVTLFGAPSAQFLGQYGAPPIAIGPLYQPKTLQLCADGDSICGDGNSPVAHGLYAVNGMVGQGANFAASRL |
| Enzyme Length | 187 |
| Uniprot Accession Number | Q79FA4 |
| Absorption | |
| Active Site | ACT_SITE 80; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:O53581; ACT_SITE 155; /evidence=ECO:0000250|UniProtKB:O53581; ACT_SITE 167; /note=Proton donor/acceptor; /evidence=ECO:0000250|UniProtKB:O53581 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: May have a role in cell wall processes (PubMed:26177502). Does not exhibit cutinase activity (PubMed:19225166). {ECO:0000269|PubMed:19225166, ECO:0000269|PubMed:26177502}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (2); Site (1) |
| Keywords | Cell membrane;Cell wall;Cytoplasm;Disulfide bond;Hydrolase;Membrane;Reference proteome;Secreted;Serine esterase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:26177502}. Cell membrane {ECO:0000269|PubMed:26177502}. Secreted, cell wall {ECO:0000269|PubMed:26177502}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,787 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |