| IED ID | IndEnz0010000169 |
| Enzyme Type ID | esterase000169 |
| Protein Name |
Acyl-protein thioesterase 1 EC 3.1.2.- Palmitoyl-protein hydrolase EC 3.1.2.22 |
| Gene Name | AGL188W |
| Organism | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Eremothecium Eremothecium gossypii (Yeast) (Ashbya gossypii) Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
| Enzyme Sequence | MSATAPIRIAARAQPAKYAFIIFHGLGDSGAGWTFLAEYLQRDPALASAQFVFPTAPVRPITANNFAPATAWLDVRSWLSHESVDLEGFNESMKLVPKLIEEQVAQGIPYERIWIGGFSQGAALTMGTALSFPHRLGGFLSFSGPPSYRWLEHTVSDANTGAPVFQSHGTMDEVFPSSGAEAVHRSFTSQYGFKNHRLKIYDGLGHSISPQLLDDALAFIKANLDAEKPAPRPAL |
| Enzyme Length | 235 |
| Uniprot Accession Number | Q750X7 |
| Absorption | |
| Active Site | ACT_SITE 119; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 172; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 206; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein]; Xref=Rhea:RHEA:19233, Rhea:RHEA-COMP:10131, Rhea:RHEA-COMP:11032, ChEBI:CHEBI:7896, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:29950, ChEBI:CHEBI:74151; EC=3.1.2.22; Evidence={ECO:0000250|UniProtKB:Q12354}; |
| DNA Binding | |
| EC Number | 3.1.2.-; 3.1.2.22 |
| Enzyme Function | FUNCTION: Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates. Mediates the deacylation of G-alpha proteins such as GPA1 in vivo, but has weak or no activity toward palmitoylated Ras proteins. Has weak lysophospholipase activity in vitro; however such activity may not exist in vivo. {ECO:0000250|UniProtKB:Q12354}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Cytoplasm;Fatty acid metabolism;Hydrolase;Lipid metabolism;Nucleus;Reference proteome;Serine esterase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q12354}. Nucleus {ECO:0000250|UniProtKB:Q12354}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,544 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:19233 |
| Cross Reference Brenda |