| IED ID | IndEnz0010000187 |
| Enzyme Type ID | esterase000187 |
| Protein Name |
Acyl-protein thioesterase 1 EC 3.1.2.- Palmitoyl-protein hydrolase EC 3.1.2.22 |
| Gene Name | CNF02430 |
| Organism | Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Agaricomycotina Tremellomycetes Tremellales (jelly fungi) Cryptococcaceae Cryptococcus Cryptococcus neoformans species complex Cryptococcus neoformans (Filobasidiella neoformans) Cryptococcus neoformans var. neoformans Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans) |
| Enzyme Sequence | MPTSLKHLKISPKEAHTATVIFLHGLGDSGHGWLPVAKMLWSSFPNVKWILPHAPTIPVSLNHGMAMPSWFDIRHLDKLDNSENDDEQGMLETLKSVDELIQAEVDSGIPENRIVLGGFSQGGAISVLNMLTTKRKLAGVVALSTWVPLNHKIVQMMSEHAKDIPVFWGHGTNDPVVDYRFGQRSVDFLVQKCGYKLLSQGTTFARPGIRFESYPGMPHSSCPQEIEDLKSWLMEALK |
| Enzyme Length | 238 |
| Uniprot Accession Number | P0CL94 |
| Absorption | |
| Active Site | ACT_SITE 120; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 174; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 219; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein]; Xref=Rhea:RHEA:19233, Rhea:RHEA-COMP:10131, Rhea:RHEA-COMP:11032, ChEBI:CHEBI:7896, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:29950, ChEBI:CHEBI:74151; EC=3.1.2.22; Evidence={ECO:0000250|UniProtKB:Q12354}; |
| DNA Binding | |
| EC Number | 3.1.2.-; 3.1.2.22 |
| Enzyme Function | FUNCTION: Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates. Mediates the deacylation of G-alpha proteins such as GPA1 in vivo, but has weak or no activity toward palmitoylated Ras proteins. Has weak lysophospholipase activity in vitro; however such activity may not exist in vivo. {ECO:0000250|UniProtKB:Q12354}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Cytoplasm;Fatty acid metabolism;Hydrolase;Lipid metabolism;Nucleus;Reference proteome;Serine esterase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q12354}. Nucleus {ECO:0000250|UniProtKB:Q12354}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,492 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:19233 |
| Cross Reference Brenda |