| IED ID | IndEnz0010000212 |
| Enzyme Type ID | esterase000212 |
| Protein Name |
Fasciculin-1 Fas-1 Fas1 Fasciculin-I FAS-I Toxin TA1 |
| Gene Name | |
| Organism | Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Elapinae Dendroaspis Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps) |
| Enzyme Sequence | TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY |
| Enzyme Length | 61 |
| Uniprot Accession Number | P0C1Y9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Interferes with neuromuscular transmission by inhibiting the enzyme acetylcholinesterase (AChE) present at the neuromuscular junction. It selectively binds and inhibits with a 1:1 stoichiometry the mammalian and electric fish AChE at picomolar concentrations. It is highly specific for the peripheral site of AChE and blocks the entry of acetylcholine into the active site of the enzyme, thereby preventing its breakdown. It has been called fasciculin since after injection into mice it causes severe, generalized and long-lasting (5-7 hours) fasciculations. {ECO:0000269|PubMed:6530667}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Chain (1); Disulfide bond (4); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Secreted;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:6530667}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1FAS; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,807 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |