| IED ID | IndEnz0010000215 |
| Enzyme Type ID | esterase000215 |
| Protein Name |
Dendrotoxin A DTX-A Fasciculin Fragment |
| Gene Name | |
| Organism | Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Elapinae Dendroaspis Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps) |
| Enzyme Sequence | TMCYSHTTTSRAILTNCGENSCYRKSRVHP |
| Enzyme Length | 30 |
| Uniprot Accession Number | Q9PS08 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits acetylcholinesterase (By similarity). Has been described to inhibit both the slowly and the rapidly inactivating phases of potassium efflux (PubMed:1304870). {ECO:0000250|UniProtKB:P0C1Z0, ECO:0000269|PubMed:1304870}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Neurotoxin;Potassium channel impairing toxin;Secreted;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:1304870}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains 4 disulfide bonds. {ECO:0000250|UniProtKB:P60301}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,418 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |