Detail Information for IndEnz0010000217
IED ID IndEnz0010000217
Enzyme Type ID esterase000217
Protein Name Pimeloyl-
acyl-carrier protein methyl ester esterase
EC 3.1.1.85
Biotin synthesis protein BioH
Carboxylesterase BioH
Gene Name bioH ECIAI1_3555
Organism Escherichia coli O8 (strain IAI1)
Taxonomic Lineage cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli O8 (strain IAI1)
Enzyme Sequence MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFISHPVEFCHLLVALKQRV
Enzyme Length 256
Uniprot Accession Number B7M1W8
Absorption
Active Site ACT_SITE 82; /note=Nucleophile; /evidence=ECO:0000255|HAMAP-Rule:MF_01260; ACT_SITE 207; /evidence=ECO:0000255|HAMAP-Rule:MF_01260; ACT_SITE 235; /evidence=ECO:0000255|HAMAP-Rule:MF_01260
Activity Regulation
Binding Site BINDING 22; /note=Substrate; via amide nitrogen and carbonyl oxygen; /evidence=ECO:0000255|HAMAP-Rule:MF_01260; BINDING 235; /note=Substrate; /evidence=ECO:0000255|HAMAP-Rule:MF_01260
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=6-carboxyhexanoyl-[ACP] methyl ester + H2O = 6-carboxyhexanoyl-[ACP] + H(+) + methanol; Xref=Rhea:RHEA:42700, Rhea:RHEA-COMP:9955, Rhea:RHEA-COMP:10186, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17790, ChEBI:CHEBI:78846, ChEBI:CHEBI:82735; EC=3.1.1.85; Evidence={ECO:0000255|HAMAP-Rule:MF_01260};
DNA Binding
EC Number 3.1.1.85
Enzyme Function FUNCTION: The physiological role of BioH is to remove the methyl group introduced by BioC when the pimeloyl moiety is complete. It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway through the hydrolysis of the ester bonds of pimeloyl-ACP esters. {ECO:0000255|HAMAP-Rule:MF_01260}.
Temperature Dependency
PH Dependency
Pathway PATHWAY: Cofactor biosynthesis; biotin biosynthesis. {ECO:0000255|HAMAP-Rule:MF_01260}.
nucleotide Binding
Features Active site (3); Binding site (2); Chain (1); Domain (1); Region (2)
Keywords Biotin biosynthesis;Cytoplasm;Hydrolase;Serine esterase
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_01260}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 28,533
Kinetics
Metal Binding
Rhea ID RHEA:42700
Cross Reference Brenda