IED ID | IndEnz0010000250 |
Enzyme Type ID | esterase000250 |
Protein Name |
Diacylglycerol acyltransferase/mycolyltransferase Ag85A DGAT EC 2.3.1.122 EC 2.3.1.20 Acyl-CoA:diacylglycerol acyltransferase Antigen 85 complex A 85A Ag85A Fibronectin-binding protein A Fbps A |
Gene Name | fbpA mpt44 BQ2027_MB3834C |
Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium bovis Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
Enzyme Sequence | MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA |
Enzyme Length | 338 |
Uniprot Accession Number | P0C2T1 |
Absorption | |
Active Site | ACT_SITE 169; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 273; /evidence=ECO:0000250; ACT_SITE 305; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | BINDING 169; /note=Substrate; /evidence=ECO:0000250; BINDING 197; /note=Substrate; /evidence=ECO:0000250; BINDING 282; /note=Substrate; /evidence=ECO:0000250 |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA; Xref=Rhea:RHEA:10868, ChEBI:CHEBI:17815, ChEBI:CHEBI:57287, ChEBI:CHEBI:58342, ChEBI:CHEBI:64615; EC=2.3.1.20; CATALYTIC ACTIVITY: Reaction=2 alpha,alpha'-trehalose 6-mycolate = alpha,alpha'-trehalose 6,6'-bismycolate + alpha,alpha-trehalose; Xref=Rhea:RHEA:23472, ChEBI:CHEBI:16551, ChEBI:CHEBI:18195, ChEBI:CHEBI:18234; EC=2.3.1.122; |
DNA Binding | |
EC Number | 2.3.1.122; 2.3.1.20 |
Enzyme Function | FUNCTION: The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor. It has a preference for C26:0-CoA over C18:1-CoA (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Binding site (3); Chain (1); Disulfide bond (1); Region (4); Signal peptide (1) |
Keywords | Acyltransferase;Cell wall;Cytoplasm;Disulfide bond;Secreted;Signal;Transferase |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall. Cytoplasm. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..42; /evidence=ECO:0000250 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 35,686 |
Kinetics | |
Metal Binding | |
Rhea ID | RHEA:10868; RHEA:23472 |
Cross Reference Brenda |