| IED ID | IndEnz0010000261 |
| Enzyme Type ID | esterase000261 |
| Protein Name |
Diacylglycerol acyltransferase/mycolyltransferase Ag85B DGAT EC 2.3.1.122 EC 2.3.1.20 30 kDa extracellular protein Acyl-CoA:diacylglycerol acyltransferase Antigen 85 complex B 85B Ag85B Extracellular alpha-antigen Fibronectin-binding protein B Fbps B |
| Gene Name | fbpB |
| Organism | Mycobacterium scrofulaceum |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium scrofulaceum |
| Enzyme Sequence | MTDLSKKVRAWGRRLLVGTAAAVTLPGLIGLAGGAPTAGAFSRPGLPVEYLQVPSAGMGRNIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIIMPVGGQSSFYSDWYSPACGKAGCTTYKWETFLTSELPQYLQSNKSVKPTGSAAVGISMAGSSALILAAYHPQQFIYAGSLSALMDPSQGMGPSLIGLAMGDAGGYKASDMWGPSSDPAWQRNDPTIQIPKLVGNNTRLWVYCGNGTPSELGGANMPAEFLENFVRSSNLKFQDAYNAAGGHNAVFHFDQNGTHSWEYWGAQLNAMKPDLQGTLGATPGGGG |
| Enzyme Length | 330 |
| Uniprot Accession Number | Q50397 |
| Absorption | |
| Active Site | ACT_SITE 166; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 270; /evidence=ECO:0000250; ACT_SITE 302; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | BINDING 166; /note=Substrate; /evidence=ECO:0000250; BINDING 194; /note=Substrate; /evidence=ECO:0000250; BINDING 279; /note=Substrate; /evidence=ECO:0000250 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 alpha,alpha'-trehalose 6-mycolate = alpha,alpha'-trehalose 6,6'-bismycolate + alpha,alpha-trehalose; Xref=Rhea:RHEA:23472, ChEBI:CHEBI:16551, ChEBI:CHEBI:18195, ChEBI:CHEBI:18234; EC=2.3.1.122; CATALYTIC ACTIVITY: Reaction=a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA; Xref=Rhea:RHEA:10868, ChEBI:CHEBI:17815, ChEBI:CHEBI:57287, ChEBI:CHEBI:58342, ChEBI:CHEBI:64615; EC=2.3.1.20; |
| DNA Binding | |
| EC Number | 2.3.1.122; 2.3.1.20 |
| Enzyme Function | FUNCTION: The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Binding site (3); Chain (1); Disulfide bond (1); Region (4); Signal peptide (1) |
| Keywords | Acyltransferase;Disulfide bond;Secreted;Signal;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..40; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 34,943 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:23472; RHEA:10868 |
| Cross Reference Brenda |