| IED ID | IndEnz0010000275 |
| Enzyme Type ID | esterase000275 |
| Protein Name |
Pimeloyl- acyl-carrier protein methyl ester esterase EC 3.1.1.85 Biotin synthesis protein BioH Carboxylesterase BioH |
| Gene Name | bioH XC_0397 |
| Organism | Xanthomonas campestris pv. campestris (strain 8004) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Xanthomonadales Xanthomonadaceae Xanthomonas Xanthomonas campestris Xanthomonas campestris pv. campestris Xanthomonas campestris pv. campestris (strain 8004) |
| Enzyme Sequence | MHIDVIGHGPALVLLHGWALHGGVFAPLVERLAPHYQLHLVDLPGHGFSHDDTTPLALPHVVAAIAAATPAAVWVGWSLGGLFALHAAATQPQVRALAMIAATPRFVRGSDWPDAVEREVFVQFGQDLARDYRGTLDRFLALDTLGSAHARSELRSLRETLTARGEPAASALQDGLGLLERTDLRRALATLARPSLWIAGQRDRLVPAAGMHAAAARAPHAQALTIDGGGHAPFLGHADQVAEALHRFVAALP |
| Enzyme Length | 253 |
| Uniprot Accession Number | Q4UZP1 |
| Absorption | |
| Active Site | ACT_SITE 78; /note=Nucleophile; /evidence=ECO:0000255|HAMAP-Rule:MF_01260; ACT_SITE 203; /evidence=ECO:0000255|HAMAP-Rule:MF_01260; ACT_SITE 231; /evidence=ECO:0000255|HAMAP-Rule:MF_01260 |
| Activity Regulation | |
| Binding Site | BINDING 18; /note=Substrate; via amide nitrogen and carbonyl oxygen; /evidence=ECO:0000255|HAMAP-Rule:MF_01260; BINDING 231; /note=Substrate; /evidence=ECO:0000255|HAMAP-Rule:MF_01260 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=6-carboxyhexanoyl-[ACP] methyl ester + H2O = 6-carboxyhexanoyl-[ACP] + H(+) + methanol; Xref=Rhea:RHEA:42700, Rhea:RHEA-COMP:9955, Rhea:RHEA-COMP:10186, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17790, ChEBI:CHEBI:78846, ChEBI:CHEBI:82735; EC=3.1.1.85; Evidence={ECO:0000255|HAMAP-Rule:MF_01260}; |
| DNA Binding | |
| EC Number | 3.1.1.85 |
| Enzyme Function | FUNCTION: The physiological role of BioH is to remove the methyl group introduced by BioC when the pimeloyl moiety is complete. It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway through the hydrolysis of the ester bonds of pimeloyl-ACP esters. {ECO:0000255|HAMAP-Rule:MF_01260}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Cofactor biosynthesis; biotin biosynthesis. {ECO:0000255|HAMAP-Rule:MF_01260}. |
| nucleotide Binding | |
| Features | Active site (3); Binding site (2); Chain (1); Region (2) |
| Keywords | Biotin biosynthesis;Cytoplasm;Hydrolase;Serine esterase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_01260}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,850 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:42700 |
| Cross Reference Brenda |