IED ID | IndEnz0010000358 |
Enzyme Type ID | esterase000358 |
Protein Name |
Acetyl esterase EC 3.1.1.- |
Gene Name | aes Ecok1_04380 APECO1_1539 |
Organism | Escherichia coli O1:K1 / APEC |
Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli O1:K1 / APEC |
Enzyme Sequence | MKPENKLPVLDLISAEMKTVVNTLQPDLPPWPATGAIAEQRQYYTLERRFWNVGAPEMATRAYRVPTKYGQVKTRLFYPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSCLLYQTLAAHQQPCEFKLYSGMLHAFLHYSRMMKTADEALRDGAQFFTAQL |
Enzyme Length | 319 |
Uniprot Accession Number | A1A8E2 |
Absorption | |
Active Site | ACT_SITE 165; /evidence=ECO:0000255|HAMAP-Rule:MF_01958; ACT_SITE 262; /evidence=ECO:0000255|HAMAP-Rule:MF_01958; ACT_SITE 292; /evidence=ECO:0000255|HAMAP-Rule:MF_01958 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.1.1.- |
Enzyme Function | FUNCTION: Displays esterase activity towards short chain fatty esters (acyl chain length of up to 8 carbons). Able to hydrolyze triacetylglycerol (triacetin) and tributyrylglycerol (tributyrin), but not trioleylglycerol (triolein) or cholesterol oleate. Negatively regulates MalT activity by antagonizing maltotriose binding. Inhibits MelA galactosidase activity. {ECO:0000255|HAMAP-Rule:MF_01958}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Chain (1); Motif (1) |
Keywords | Cytoplasm;Hydrolase;Serine esterase |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_01958}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | MOTIF 91..93; /note=Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole; /evidence=ECO:0000250|UniProtKB:Q5NUF3 |
Gene Encoded By | |
Mass | 36,083 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |