| IED ID | IndEnz0010000369 |
| Enzyme Type ID | esterase000369 |
| Protein Name |
Probable carboxylesterase Culp3 EC 3.1.1.- Cutinase-like protein 3 Culp3 |
| Gene Name | cut3 Rv3451 MTCY13E12.04 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Enzyme Sequence | MNNRPIRLLTSGRAGLGAGALITAVVLLIALGAVWTPVAFADGCPDAEVTFARGTGEPPGIGRVGQAFVDSLRQQTGMEIGVYPVNYAASRLQLHGGDGANDAISHIKSMASSCPNTKLVLGGYSQGATVIDIVAGVPLGSISFGSPLPAAYADNVAAVAVFGNPSNRAGGSLSSLSPLFGSKAIDLCNPTDPICHVGPGNEFSGHIDGYIPTYTTQAASFVVQRLRAGSVPHLPGSVPQLPGSVLQMPGTAAPAPESLHGR |
| Enzyme Length | 262 |
| Uniprot Accession Number | P9WP39 |
| Absorption | |
| Active Site | ACT_SITE 125; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:O53581; ACT_SITE 192; /evidence=ECO:0000250|UniProtKB:O53581; ACT_SITE 206; /note=Proton donor/acceptor; /evidence=ECO:0000250|UniProtKB:O53581 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Shows weak esterase activity with the p-nitrophenol-linked aliphatic ester pNP-butyrate. Does not exhibit cutinase activity. {ECO:0000269|PubMed:19225166}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (2); Region (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Hydrolase;Reference proteome;Secreted;Serine esterase;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..41; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,504 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |