| IED ID | IndEnz0010000394 |
| Enzyme Type ID | esterase000394 |
| Protein Name |
Acetylxylan esterase A EC 3.1.1.72 |
| Gene Name | axeA aceA AN6093 |
| Organism | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Nidulantes Emericella nidulans (Aspergillus nidulans) Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Enzyme Sequence | MVKLQYLLSILLYAYSCTALMLDRRDPTPGQLSQVTDFGDNPTNVGFYIYVPQNLASNPAIIVAIHYCTGTAQAYYSGTPYAQYAETYGFIVIYPESPYSGTCWDVSSQSTLTHNGGGNSNSIANMVDWTINQYNADASRVYVTGTSSGAMMTNVMAATYPNLFAAGIAYAGVPAGCFYSEANVEDQWNSTCAQGQSISTPEHWAQIAQAMYSGYEGSRPKMQIYHGSADATLYPQNYYETCKQWAGVFGYNYDSPQEVQNDTPVAGWAKTIWGENLQGILADGVGHNIQIQGEEDLKWFGFTS |
| Enzyme Length | 304 |
| Uniprot Accession Number | Q5B037 |
| Absorption | |
| Active Site | ACT_SITE 147; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Deacetylation of xylans and xylo-oligosaccharides.; EC=3.1.1.72; |
| DNA Binding | |
| EC Number | 3.1.1.72 |
| Enzyme Function | FUNCTION: Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone. {ECO:0000269|PubMed:16844780}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 49 degrees Celsius. {ECO:0000269|PubMed:16844780}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.5. {ECO:0000269|PubMed:16844780}; |
| Pathway | PATHWAY: Glycan degradation; xylan degradation. |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Erroneous gene model prediction (2); Glycosylation (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Cellulose degradation;Glycoprotein;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Serine esterase;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 33,302 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |