| IED ID | IndEnz0010000404 |
| Enzyme Type ID | esterase000404 |
| Protein Name |
Acyl-coenzyme A thioesterase 9, mitochondrial Acyl-CoA thioesterase 9 EC 3.1.2.- Acyl coenzyme A thioester hydrolase 2 MTE-2 Acyl-CoA thioester hydrolase 9 Mitochondrial 48 kDa acyl-CoA thioester hydrolase 1 Mt-ACT48.1 Protein U8 p48 |
| Gene Name | Acot9 Acate2 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MKRAAIRLWTLNKGLLTHGRGLSQGSQYKISEPLHIHQVRDKLREIVGVSTVWRDHVKAMEERKLLHSFLPKSQKVLPPRKMRDSYIEVLLPLGTDPELRDKYVTVQNTVRFGRILEDLDSLGVLVCYMHNHNHSTKMSPLSIVTVLVDKIDMCKHSLSPEQDIKFTGHVSWVGNTSMEVKMKMFQLHNDEKYWPVLDATFVMVARDSENKGPAFVNPLIPENKEEEELFKQGELNKSRRIAFSTSSLLKVAPSSEERNIIHELFLTTLDPKTISFQSRILPPKAVWMEDTKLKSLDICHPQERNVFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSSQVCFTQDNYIQVRVHSEVSSLDSREHMTTNVFHFTFMSEKEVPLIFPKTYGESMLYLDGQRHFKSMSTPVTLKKDYPVEP |
| Enzyme Length | 439 |
| Uniprot Accession Number | Q9R0X4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.2.- |
| Enzyme Function | FUNCTION: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Active on long chain acyl-CoAs. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (2); Modified residue (1); Sequence conflict (1); Transit peptide (1) |
| Keywords | Acetylation;Direct protein sequencing;Hydrolase;Mitochondrion;Reference proteome;Repeat;Serine esterase;Transit peptide |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000305|PubMed:10383425}. |
| Modified Residue | MOD_RES 102; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:Q9Y305 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10725249; 11217851; 12466851; 14610273; 16103133; 16615898; 18614015; 21267068; 23864032; 31676684; |
| Motif | |
| Gene Encoded By | |
| Mass | 50,560 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.1.2.2;3.1.2.20; |