| IED ID | IndEnz0010000432 |
| Enzyme Type ID | esterase000432 |
| Protein Name |
Repressed By RIM101 protein 2 EC 3.1.1.- Predicted GPI-anchored protein 21 |
| Gene Name | RBR2 PGA21 CAALFM_CR04420CA CaO19.532 CaO19.8165 |
| Organism | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Debaryomycetaceae Candida/Lodderomyces clade Candida Candida albicans (Yeast) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Enzyme Sequence | MRFAFTTVSLSLLLSSLVASDAASSDVQFLTALVGDYQDHKTDYIKFFATAKDVPGDLSTLATKVLTYTDDSYTTLLNDDSLNVSNLEAYATSLPWYSRIQADAGGKGSASGSASGSGSAKSTASAEKSSGSSASASSTAGGSSSKGGVSELVAPVGAVVGALAVALM |
| Enzyme Length | 168 |
| Uniprot Accession Number | Q5A6M2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Probable cell wall protein which may have esterase activity, with a preference for esters of fatty acids from 4 to 16 carbon atoms. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Glycosylation (1); Lipidation (1); Propeptide (1); Region (1); Signal peptide (1) |
| Keywords | Cell wall;GPI-anchor;Glycoprotein;Hydrolase;Lipoprotein;Membrane;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Expression is regulated upon white-opaque switching. Repressed by RIM101 and alpha pheromone, and up-regulated upon interaction with macrophages. {ECO:0000269|PubMed:12397174, ECO:0000269|PubMed:15189998, ECO:0000269|PubMed:16987174, ECO:0000269|PubMed:17164403}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000250}. Membrane {ECO:0000305}; Lipid-anchor, GPI-anchor {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: The GPI-anchor is attached to the protein in the endoplasmic reticulum and serves to target the protein to the cell surface. There, the glucosamine-inositol phospholipid moiety is cleaved off and the GPI-modified mannoprotein is covalently attached via its lipidless GPI glycan remnant to the 1,6-beta-glucan of the outer cell wall layer (By similarity). {ECO:0000250}. |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,830 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |