| IED ID | IndEnz0010000449 |
| Enzyme Type ID | esterase000449 |
| Protein Name |
Pectinesterase inhibitor 9 Pectin methylesterase inhibitor 9 AtPMEI9 |
| Gene Name | PMEI9 At1g62770 F23N19.14 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MELKNTIFLVILLSITILQSSSATPNRSESDQFIVSSCQTTQYPSLCVHTLSAYATKIRHNNDQDLAQTALIISLARAKSVTIFVAKLTKETPKFKRREYLAIKDCIEVLGNSVDRLAQSVKELARAGHAVASEDFMWKMSNVQTWVSAALTDETTCLDGFSERAMGGKVKRLIRYKVVHVAQVTSNALALVNQFAEKRSVKFP |
| Enzyme Length | 204 |
| Uniprot Accession Number | Q9SI72 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Pectin methylesterase (PME) inhibitor that probably targets root-expressed PME, regulates de-methylesterification of pectins in roots and affects root growth. {ECO:0000269|PubMed:28034952}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Frameshift (1); Glycosylation (1); Signal peptide (1) |
| Keywords | Apoplast;Disulfide bond;Glycoprotein;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, apoplast {ECO:0000250|UniProtKB:Q9STY5}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15086809; 16813576; 17435085; 18252844; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,684 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |