| IED ID | IndEnz0010000480 |
| Enzyme Type ID | esterase000480 |
| Protein Name |
Aclacinomycin methylesterase RdmC EC 3.1.1.95 |
| Gene Name | rdmC |
| Organism | Streptomyces purpurascens |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces purpurascens |
| Enzyme Sequence | MSERIVPSGDVELWSDDFGDPADPALLLVMGGNLSALGWPDEFARRLADGGLHVIRYDHRDTGRSTTRDFAAHPYGFGELAADAVAVLDGWGVDRAHVVGLSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDGLPGPQQPFLDALALMNQPAEGRAAEVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPTARLAEIPGMGHALPSSVHGPLAEVILAHTRSAA |
| Enzyme Length | 298 |
| Uniprot Accession Number | Q54528 |
| Absorption | |
| Active Site | ACT_SITE 102; /evidence=ECO:0000255; ACT_SITE 248; /evidence=ECO:0000255; ACT_SITE 276; /evidence=ECO:0000255 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=aclacinomycin T + H2O = 15-demethylaclacinomycin T + methanol; Xref=Rhea:RHEA:37891, ChEBI:CHEBI:15377, ChEBI:CHEBI:17790, ChEBI:CHEBI:74354, ChEBI:CHEBI:77979; EC=3.1.1.95; Evidence={ECO:0000269|PubMed:11004563}; |
| DNA Binding | |
| EC Number | 3.1.1.95 |
| Enzyme Function | FUNCTION: Involved in the biosynthesis of the anthracycline aclacinomycin which is an aromatic polyketide antibiotic that exhibits high cytotoxicity and is widely applied in the chemotherapy of a variety of cancers. Catalyzes the removal of the methoxy group from the C-15 position of aclacinomycin T and A to yield 15-demethoxyaclacinomycin T and A, respectively. {ECO:0000269|PubMed:11004563, ECO:0000269|PubMed:7751313}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 37 degrees Celsius. The activity at 30 and 45 degrees Celsius is 58% and 87% of the optimal activity, respectively. Exceptionally high temperature stability. {ECO:0000269|PubMed:11004563}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.5. {ECO:0000269|PubMed:11004563}; |
| Pathway | PATHWAY: Antibiotic biosynthesis; aclacinomycin biosynthesis. |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (10); Chain (1); Domain (1); Helix (14); Initiator methionine (1); Turn (3) |
| Keywords | 3D-structure;Antibiotic biosynthesis;Direct protein sequencing;Hydrolase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1Q0R; 1Q0Z; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 31,792 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=15.5 uM for aclacinomycin T (at pH 7.5 and 37 degrees Celsius) {ECO:0000269|PubMed:11004563}; |
| Metal Binding | |
| Rhea ID | RHEA:37891 |
| Cross Reference Brenda | 3.1.1.95; |