| IED ID | IndEnz0010000496 |
| Enzyme Type ID | esterase000496 |
| Protein Name |
Pectinesterase inhibitor 3 Pectin methylesterase inhibitor 3 AtPMEI3 |
| Gene Name | PMEI3 At5g20740 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAPTQNLFLVAIAFAVIFTASTVHGRHNGAEDIVHSSCEHASYPSLCVRTLSSYSGPTITNRRDLAQAAIKISLSHAQSAAKKLAVVRDSVGKKKQEKAALVDCVEMIGDSVDELSRTLGVLKHLRVSGGSAKEFRWQMSNAQTWASAALTDDDTCLDGFQGMDDGEIKTEVKQWMTKVARVTSNALYMVNQLDETRGKPHDVHL |
| Enzyme Length | 205 |
| Uniprot Accession Number | Q84WE4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Pectin methylesterase (PME) inhibitor that regulates de-methylesterification of pectins in the apical meristem and affects primordia formation and phyllotactic patterning. {ECO:0000269|PubMed:19097903}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Sequence conflict (4); Signal peptide (1) |
| Keywords | Alternative splicing;Apoplast;Disulfide bond;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Down-regulated in leaves during infection with Botrytis cinerea. {ECO:0000269|PubMed:28082716}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, apoplast {ECO:0000250|UniProtKB:Q9STY5}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 17497164; 21245191; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,329 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |