IED ID | IndEnz0010000496 |
Enzyme Type ID | esterase000496 |
Protein Name |
Pectinesterase inhibitor 3 Pectin methylesterase inhibitor 3 AtPMEI3 |
Gene Name | PMEI3 At5g20740 |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
Enzyme Sequence | MAPTQNLFLVAIAFAVIFTASTVHGRHNGAEDIVHSSCEHASYPSLCVRTLSSYSGPTITNRRDLAQAAIKISLSHAQSAAKKLAVVRDSVGKKKQEKAALVDCVEMIGDSVDELSRTLGVLKHLRVSGGSAKEFRWQMSNAQTWASAALTDDDTCLDGFQGMDDGEIKTEVKQWMTKVARVTSNALYMVNQLDETRGKPHDVHL |
Enzyme Length | 205 |
Uniprot Accession Number | Q84WE4 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Pectin methylesterase (PME) inhibitor that regulates de-methylesterification of pectins in the apical meristem and affects primordia formation and phyllotactic patterning. {ECO:0000269|PubMed:19097903}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (2); Sequence conflict (4); Signal peptide (1) |
Keywords | Alternative splicing;Apoplast;Disulfide bond;Reference proteome;Secreted;Signal |
Interact With | |
Induction | INDUCTION: Down-regulated in leaves during infection with Botrytis cinerea. {ECO:0000269|PubMed:28082716}. |
Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, apoplast {ECO:0000250|UniProtKB:Q9STY5}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 17497164; 21245191; |
Motif | |
Gene Encoded By | |
Mass | 22,329 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |